PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00003.1.g01520.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 438aa    MW: 48107.7 Da    PI: 5.3068
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00003.1.g01520.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-33230284155
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                     k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv++Lt+ hvkSHLQkYR+
  Zjn_sc00003.1.g01520.1.am.mkhc 230 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVDDLTIFHVKSHLQKYRT 284
                                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.785227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-31228286IPR009057Homeodomain-like
SuperFamilySSF466897.53E-18229284IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-25230284IPR006447Myb domain, plants
PfamPF002498.5E-9232283IPR001005SANT/Myb domain
PfamPF143793.2E-24313360IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MQKFNLMQSQ NSRVVGAMSS SLPVLPNAMK ESLPKPHNPH YLPMSRQLLN DSIPLCHGAL  60
QSTPLHPRDG VIGSPFANYC ASQNDSVSNH ERQSIVASFI SRAANVEVFQ PLSDNYIDAQ  120
TEAAWFTSSM DVLPGYIDNV AAPDNQIQSG ISAIASTEIA NQNELWEQLM NDDWKDILDA  180
TATDSQSKTM VQHSNSTASQ PAMNQPASSL SGEICPVASP PNSSNASAAK QRMRWTPELH  240
ECFVDAVNQL GGSEKATPKG VLKLMKVDDL TIFHVKSHLQ KYRTARYKPD LSEGSSEKRT  300
TTEELSFDLK TSMDLTEALR LQMDVQKRLH EQLENQRKLQ LRIEEQGKYL QMMLEKQCKS  360
TTGKVQDPES GDAAPDLSHS ADKDCGATVD QNRTGDKPGI ADPVGLKQKL AEADSDPQAA  420
ADDGVSTSQE KRRKLQDS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984501.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_004984500.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLK4A9X60.0K4A9X6_SETIT; Uncharacterized protein
STRINGSi035682m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.14e-65phosphate starvation response 1